| Edit |   |
|---|
| Antigenic Specificity | MAGED4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | guinea pig, human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MAGED4B Antibody |
|---|
| Immunogen | The immunogen for anti-Magee1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE |
|---|
| Other Names | melanoma antigen family D, 4B |
|---|
| Gene, Accession # | MAGD4, Accession: NM_030801 |
|---|
| Catalog # | TA344751 |
|---|
| Price | |
|---|
| Order / More Info | MAGED4B Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|