Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Optimal dilution of this antibody should be experimentally determined.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor? 750] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha 3/CD49c. This antibody reacts with human. The Integrin alpha 3/CD49c Antibody (29A3) [Alexa Fluor? 750] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A
Immunogen
Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Other Names
antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a