| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Integrin beta 1/CD29 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Integrin beta 1/CD29 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin beta 1/CD29. This antibody reacts with human. The Integrin beta 1/CD29 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP |
| Other Names | CD29, CD29 antigen, Fibronectin receptor subunit beta, FNRBVLAB, GPIIA, integrin beta-1, integrin VLA-4 beta subunit, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includesMDF2, MSK12), MDF2, MSK12, very late activation protein, beta polypeptide, VLA-4 subunit beta, VLA-BETA |
| Gene, Accession # | ITGB1, Gene ID: 3688 |
| Catalog # | NBP2-62630 |
| Price | |
| Order / More Info | Integrin beta 1/CD29 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|