| Edit |   |
|---|
| Antigenic Specificity | GLIPR1L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal Anti-GLIPR1L1 Antibody |
|---|
| Immunogen | The immunogen for anti-GLIPR1L1 antibody: synthetic peptide directed towards the middle region of human GLIPR1L1. Synthetic peptide located within the following region: NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL |
|---|
| Other Names | ALKN2972, PRO7434, GLI pathogenesis-related 1 like 1 |
|---|
| Gene, Accession # | GPRL1, Accession: NM_152779 |
|---|
| Catalog # | TA329798 |
|---|
| Price | |
|---|
| Order / More Info | GLIPR1L1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|