| Edit |   |
|---|
| Antigenic Specificity | GNA15 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, human, mouse, porcine, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG |
|---|
| Other Names | GNA16, guanine nucleotide binding protein (G protein), alpha 15 (Gq class) |
|---|
| Gene, Accession # | GNA15, Accession: NM_002068 |
|---|
| Catalog # | TA344323 |
|---|
| Price | |
|---|
| Order / More Info | GNA15 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|