| Edit |   |
| Antigenic Specificity | Solute Carrier Family 33 Member 1 (SLC33A1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm. |
| Immunogen | SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG |
| Other Names | zgc:63693|ACATN|AT-1|AT1|CCHLND|SPG42|AI315656|AI788741|Acatn|D630022N01Rik |
| Gene, Accession # | Gene ID: 9197,11416,64018 |
| Catalog # | ABIN635371 |
| Price | |
| Order / More Info | Solute Carrier Family 33 Member 1 (SLC33A1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |