If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Immunogen
FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Other Names
CG10611|CG31692|Dmel\\CG31692|FbPase|fbp1|cb598|fb57b01|zgc:64127|id:ibd1091|wu:fb17g10|wu:fb57b01|fbp2|FBP1|high cyclic electron flow 1|fdp|xcc-b100_0105|Folbp-1|Folbp1|Fbp-2|Fbp2|Fbp3|FBP|Fdp|fbp1l|fk92h02|wu:fk92h02|zgc:64096