| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Fructose-1,6-Bisphosphatase 1 (FBP1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis. |
| Immunogen | FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
| Other Names | CG10611|CG31692|Dmel\\CG31692|FbPase|fbp1|cb598|fb57b01|zgc:64127|id:ibd1091|wu:fb17g10|wu:fb57b01|fbp2|FBP1|high cyclic electron flow 1|fdp|xcc-b100_0105|Folbp-1|Folbp1|Fbp-2|Fbp2|Fbp3|FBP|Fdp|fbp1l|fk92h02|wu:fk92h02|zgc:64096 |
| Gene, Accession # | Gene ID: 2203,14275 |
| Catalog # | ABIN629795 |
| Price | |
| Order / More Info | Fructose-1,6-Bisphosphatase 1 (FBP1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|