If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains.
Immunogen
DYNLL1 antibody was raised using the middle region of DYNLL1 corresponding to a region with amino acids EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL