| Edit |   |
| Antigenic Specificity | A Kinase (PRKA) Anchor Protein 5 (AKAP5) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT. |
| Immunogen | AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE |
| Other Names | AKAP5|AKAP75|AKAP79|H21|AKAP|P75|3526401B18Rik|AKAP 150|AKAP-5|AKAP150|BB098886|Gm258|P150|Akap79 |
| Gene, Accession # | Gene ID: 9495 |
| Catalog # | ABIN631131 |
| Price | |
| Order / More Info | A Kinase (PRKA) Anchor Protein 5 (AKAP5) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |