| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | CCL14/HCC-1/HCC-3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCL14/HCC-1/HCC-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCL14/HCC-1/HCC-3. This antibody reacts with human. The CCL14/HCC-1/HCC-3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCL14/HCC-1/HCC-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKE |
| Other Names | C-C motif chemokine 14, chemokine (C-C motif) ligand 14, Chemokine CC-1/CC-3, chemokine CC-3, CKB1, FLJ16015, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, hemofiltrate CC chemokine 1, MCIF, member 14, NCC2CC-1, NCC-2CKb1, new CC chemokine 2, SCYA14CC-3, Small-inducible cytokine A14 |
| Gene, Accession # | CCL14, Gene ID: 6358 |
| Catalog # | NBP1-85595 |
| Price | |
| Order / More Info | CCL14/HCC-1/HCC-3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|