| Edit |   |
|---|
| Antigenic Specificity | AAVR/KIAA0319L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AAVR/KIAA0319L Antibody from Novus Biologicals is a rabbit polyclonal antibody to AAVR/KIAA0319L. This antibody reacts with human. The AAVR/KIAA0319L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KIAA0319L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQ |
|---|
| Other Names | FLJ44532, KIAA0319-like, KIAA1837dyslexia-associated protein KIAA0319-like protein, polycystic kidney disease 1-related |
|---|
| Gene, Accession # | KIAA0319L, Gene ID: 79932 |
|---|
| Catalog # | NBP2-57263 |
|---|
| Price | |
|---|
| Order / More Info | AAVR/KIAA0319L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|