Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The MAX binding protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAX binding protein. This antibody reacts with human. The MAX binding protein Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MAX binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA
Other Names
BHLHD3, bHLHd3Max-interacting protein, Class D basic helix-loop-helix protein 3, MAD6, MAX binding protein, MXD6, Myc antagonist MNT, Protein ROX, ROXmax-binding protein MNT