If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PPP2R5E Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R5E. This antibody reacts with mouse. The PPP2R5E Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: epsilon isoform
Immunogen
Synthetic peptides corresponding to the N terminal of Ppp2r5e. Immunizing peptide sequence SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP.
Other Names
epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform