| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ERGIC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ERGIC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERGIC1. This antibody reacts with human. The ERGIC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ERGIC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK |
| Other Names | endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1, endoplasmic reticulum-Golgi intermediate compartment protein 1, ERGIC-32FLJ39864, ERGIC32MGC14345, ER-Golgi intermediate compartment 32 kDa protein, KIAA1181endoplasmic reticulum-golgi intermediate compartment 32 kDa protein, NET24 |
| Gene, Accession # | ERGIC1, Gene ID: 57222 |
| Catalog # | NBP1-83963 |
| Price | |
| Order / More Info | ERGIC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|