| 產品詳情 |
| Edit |   |
| Antigenic Specificity | SLC7A6OS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC7A6OS Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC7A6OS. This antibody reacts with human. The SLC7A6OS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC7A6OS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVATVCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLS |
| Other Names | ADAMS proteinase-related protein, FLJ13291, protein SLC7A6OS, Solute carrier family 7 member 6 opposite strand transcript, solute carrier family 7, member 6 opposite strand |
| Gene, Accession # | SLC7A6OS, Gene ID: 84138 |
| Catalog # | NBP1-82260 |
| Price | |
| Order / More Info | SLC7A6OS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產品資料 |
|
|