If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The MNAB Antibody from Novus Biologicals is a rabbit polyclonal antibody to MNAB. This antibody reacts with human. The MNAB Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to RC3H2(ring finger and CCCH-type zinc finger domains 2) The peptide sequence was selected from the middle region of RC3H2. Peptide sequence YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR.
Other Names
FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164