| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PCIF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCIF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCIF1. This antibody reacts with human. The PCIF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PCIF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSI PGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR |
| Other Names | bA465L10.1, C20orf67, chromosome 20 open reading frame 67, PDX-1 C terminus-interacting factor 1, PDX1 C-terminal inhibiting factor 1, phosphorylated CTD-interacting factor 1 |
| Gene, Accession # | PCIF1, Gene ID: 63935 |
| Catalog # | NBP2-13740 |
| Price | |
| Order / More Info | PCIF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|