| Edit |   |
|---|
| Antigenic Specificity | Nucleoporin 35kDa (NUP35) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. |
|---|
| Immunogen | NUP35 antibody was raised using the N terminal of NUP35 corresponding to a region with amino acids MLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPL |
|---|
| Other Names | MGC64281|nup53|2310006I24Rik|35kDa|5330402E05Rik|MP44|NO44|fj68d11|wu:fj68d11|zgc:65979|NP44|NUP53 |
|---|
| Gene, Accession # | Gene ID: 129401,69482,295692 |
|---|
| Catalog # | ABIN630745 |
|---|
| Price | |
|---|
| Order / More Info | Nucleoporin 35kDa (NUP35) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|