If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.
Immunogen
Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP