If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair.
Immunogen
CK1 delta antibody was raised using the middle region of CSNK1 D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR