| Edit |   |
|---|
| Antigenic Specificity | GRF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRF2. This antibody reacts with human. The GRF2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RAPGEF1(Rap guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the C terminal of RAPGEF1 (NP_005303). Peptide sequence LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK. |
|---|
| Other Names | C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene), CRK SH3-binding GNRP, DKFZp781P1719, Guanine nucleotide-releasing factor 2, Protein C3G, Rap guanine nucleotide exchange factor (GEF) 1, rap guanine nucleotide exchange factor 1 |
|---|
| Gene, Accession # | RAPGEF1, Gene ID: 2889, Accession: Q13905, SwissProt: Q13905 |
|---|
| Catalog # | NBP1-58306 |
|---|
| Price | |
|---|
| Order / More Info | GRF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|