| Edit |   |
| Antigenic Specificity | HAUS Augmin-Like Complex, Subunit 7 (HAUS7) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom |
| Immunogen | UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC |
| Other Names | UCHL5IP|UIP1|1110020L19Rik|Uchl5ip|Uip1|RGD1562991 |
| Gene, Accession # | Gene ID: 55559 |
| Catalog # | ABIN632374 |
| Price | |
| Order / More Info | HAUS Augmin-Like Complex, Subunit 7 (HAUS7) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |